PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014895P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 345aa    MW: 38705.7 Da    PI: 7.2077
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014895P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.1e-4159136178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +C v+gC++dl+++k+yhrrh+vC+ hsk+pvv+v+g+e+rfCqqCsrfh+l efDe krsCr+rL++hn+rrrk+q+
  MELO3C014895P1  59 TCLVDGCDTDLTNCKDYHRRHRVCDSHSKTPVVMVRGEEKRFCQQCSRFHSLGEFDEVKRSCRKRLDGHNRRRRKPQP 136
                     5**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-3254121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.49657134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.32E-3859139IPR004333Transcription factor, SBP-box
PfamPF031101.6E-3060133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDWVWGKFSG EPNFPENKQN PPSSFSDSIG SNKGSSQESS SSHGSSKRTR LLHGNQNQTC  60
LVDGCDTDLT NCKDYHRRHR VCDSHSKTPV VMVRGEEKRF CQQCSRFHSL GEFDEVKRSC  120
RKRLDGHNRR RRKPQPESLF MSSRDFLSNC KGPIVLQFSD QQIHHVSDEI GRSLWPVRTE  180
GEKKSSVVPS NSSAYFSYGR GDNKELPFFL HKNGKRQSKQ MVSSQLSFNQ QLPDVISQGS  240
EVDNQKPVTT DTSPEDSGCA LYLLSSRTVQ AHSDAGLSSL VQSHLSVPVQ THETELHFSS  300
LSDFSGSFDS KDKPVSSQLG LEMEEESDGL FQNEAPHKFP ISWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2558133984squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818570.0LN681857.1 Cucumis melo genomic scaffold, anchoredscaffold00023.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450118.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A0A0L8950.0A0A0A0L895_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100312640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.17e-45SBP family protein